PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_34670V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 605aa    MW: 66984.2 Da    PI: 8.5957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_34670V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16159204147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ed++l ++v q+G+ +W++Ia+++  gR++k+c++rw++ 
  Pp3c2_34670V3.1.p 159 RGHWRPAEDDKLRELVSQYGPQNWNLIAEKLH-GRSGKSCRLRWFNQ 204
                        899*****************************.***********996 PP

2Myb_DNA-binding551.9e-17211255147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r ++T+eE+++l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ +
  Pp3c2_34670V3.1.p 211 RRPFTEEEEDRLLSAHRFHGNK-WAMIARLFP-GRTDNAVKNHWHVV 255
                        679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.228154205IPR017930Myb domain
SuperFamilySSF466897.11E-29158252IPR009057Homeodomain-like
SMARTSM007176.2E-14158207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-27160212IPR009057Homeodomain-like
PfamPF139213.4E-16162222No hitNo description
CDDcd001671.16E-12162203No hitNo description
PROSITE profilePS5129425.29206260IPR017930Myb domain
SMARTSM007179.1E-15210258IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-20213259IPR009057Homeodomain-like
CDDcd001672.58E-11213256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MVSMEERGSS WSPIATKFMG RSHSFAEEAQ RKRSSPRHVA QSLGRWPQNW VQDRDTIRRS  60
SSVGFSPTDT MTTDGERTSN SGSDTLAGNC IPFQVLVNAS GEERAWCMRS VESSSGLKLS  120
SDDDLEHGSM EDEMKESNED MENFLGKDGE SVQSKLCPRG HWRPAEDDKL RELVSQYGPQ  180
NWNLIAEKLH GRSGKSCRLR WFNQLDPRIN RRPFTEEEED RLLSAHRFHG NKWAMIARLF  240
PGRTDNAVKN HWHVVMARKF RERSRQFGRR KPQANRRGEL RSSNSDVSNY HSSADFLTSW  300
IEKHAVAGDQ TVEACDGSGA PPANPRASLS RSRSPTAHPN TFTKPQFPGG NLQVRDVVNN  360
VSDASSILPR FSGFGSVPLA APSLLPSSGG VIADPRAVYL SGLTNSEKHQ QALVNNPTDR  420
QGSTGHLKEE HADKGSFHRL LPTESSTSGL KTTLQGSLYG SHWNRPSPPN PSGYSQTNGD  480
EVVELHETYA DHPHRSEMAR PLSLGRSGNK YEAIHSFRVA PAFSRQDTTK ELGNWIPLPV  540
PGHEHQHLQK RLRKDGANPS KLGLTSWVPC EKPEDTVVAE AATLHSSSVT VPVPFIDFLG  600
VGAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-301592597107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S76_66V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-65myb domain protein 105